Lineage for d1d7ca_ (1d7c A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764503Superfamily b.1.9: CBD9-like [49344] (4 families) (S)
    has additional strand at N-terminus; the active site in a similar topological location as the Cu,Zn SOD site
  5. 2764504Family b.1.9.1: Cytochrome domain of cellobiose dehydrogenase [49345] (1 protein)
  6. 2764505Protein Cytochrome domain of cellobiose dehydrogenase [49346] (1 species)
  7. 2764506Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [49347] (4 PDB entries)
  8. 2764513Domain d1d7ca_: 1d7c A: [22309]
    complexed with 1pg, cd, hem

Details for d1d7ca_

PDB Entry: 1d7c (more details), 1.9 Å

PDB Description: cytochrome domain of cellobiose dehydrogenase, ph 4.6
PDB Compounds: (A:) cellobiose dehydrogenase

SCOPe Domain Sequences for d1d7ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7ca_ b.1.9.1 (A:) Cytochrome domain of cellobiose dehydrogenase {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
esasqftdpttgfqftgitdpvhdvtygfvfpplatsgaqstefigevvapiaskwigia
lggamnndlllvawangnqivsstrwatgyvqptaytgtatlttlpettinsthwkwvfr
cqgctewnngggidvtsqgvlawafsnvavddpsdpqstfsehtdfgffgidystahsan
yqnylngdsg

SCOPe Domain Coordinates for d1d7ca_:

Click to download the PDB-style file with coordinates for d1d7ca_.
(The format of our PDB-style files is described here.)

Timeline for d1d7ca_: