![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d4i9wd1: 4i9w D:1-106 [223082] Other proteins in same PDB: d4i9wd2, d4i9we_, d4i9wf2, d4i9wg_ automated match to d1eo8l1 complexed with ca, k |
PDB Entry: 4i9w (more details), 2.75 Å
SCOPe Domain Sequences for d4i9wd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i9wd1 b.1.1.0 (D:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar fsgsgsgtsysltissmeaedaatyycqqwsnspptfgagaklelk
Timeline for d4i9wd1:
![]() Domains from other chains: (mouse over for more information) d4i9we_, d4i9wf1, d4i9wf2, d4i9wg_ |