Lineage for d4i9wd1 (4i9w D:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760221Domain d4i9wd1: 4i9w D:1-106 [223082]
    Other proteins in same PDB: d4i9wd2, d4i9we_, d4i9wf2, d4i9wg_
    automated match to d1eo8l1
    complexed with ca, k

Details for d4i9wd1

PDB Entry: 4i9w (more details), 2.75 Å

PDB Description: Human two pore domain K+ channel TRAAK (K2P4.1) - Fab complex structure
PDB Compounds: (D:) antibody fab fragment light chain

SCOPe Domain Sequences for d4i9wd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i9wd1 b.1.1.0 (D:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
fsgsgsgtsysltissmeaedaatyycqqwsnspptfgagaklelk

SCOPe Domain Coordinates for d4i9wd1:

Click to download the PDB-style file with coordinates for d4i9wd1.
(The format of our PDB-style files is described here.)

Timeline for d4i9wd1: