SCOPe 2.08: Domain d4i9wd1: 4i9w D:1-106

Lineage for d4i9wd1 (4i9w D:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4i9wd1: 4i9w D:1-106 [223082]
   Other proteins in same PDB: d4i9wd2, d4i9we_, d4i9wf2, d4i9wg_
   automated match to d1eo8l1
   complexed with ca, k

Details for d4i9wd1

PDB Entry: 4i9w, 2.75 Å

PDB Description: Human two pore domain K+ channel TRAAK (K2P4.1) - Fab complex structure

PDB Compounds: (D:) antibody fab fragment light chain

SCOPe Domain Sequences for d4i9wd1:

Sequence; same for both SEQRES and ATOM records:

>d4i9wd1 b.1.1.0 (D:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
fsgsgsgtsysltissmeaedaatyycqqwsnspptfgagaklelk

Timeline for d4i9wd1:

• d4i9wd1 first appeared in SCOPe 2.03
  
• d4i9wd1 appears in SCOPe 2.07