SCOP 1.59: Domain d1d7ba_: 1d7b A:

Lineage for d1d7ba_ (1d7b A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.9: CBD9-like [49344] (2 families)

5. Family b.1.9.1: Cytochrome domain of cellobiose dehydrogenase [49345] (1 protein)

6. Protein Cytochrome domain of cellobiose dehydrogenase [49346] (1 species)

7. Species Fungus (Phanerochaete chrysosporium) [TaxId:5306] [49347] (3 PDB entries)

8. Domain d1d7ba_: 1d7b A: [22307]

Details for d1d7ba_

PDB Entry: 1d7b, 1.9 Å

PDB Description: cytochrome domain of cellobiose dehydrogenase, ph 7.5

SCOP Domain Sequences for d1d7ba_:

Sequence; same for both SEQRES and ATOM records:

>d1d7ba_ b.1.9.1 (A:) Cytochrome domain of cellobiose dehydrogenase {Fungus (Phanerochaete chrysosporium)}
esasqftdpttgfqftgitdpvhdvtygfvfpplatsgaqstefigevvapiaskwigia
lggamnndlllvawangnqivsstrwatgyvqptaytgtatlttlpettinsthwkwvfr
cqgctewnngggidvtsqgvlawafsnvavddpsdpqstfsehtdfgffgidystahsan
yqnyln

Timeline for d1d7ba_:

• d1d7ba_ first appeared (with stable ids) in SCOP 1.55
  
• d1d7ba_ appears in SCOP 1.57
  
• d1d7ba_ appears in SCOP 1.61
  
• d1d7ba_ appears in the current release, SCOPe 2.08