![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.9: CBD9-like [49344] (2 families) ![]() |
![]() | Family b.1.9.1: Cytochrome domain of cellobiose dehydrogenase [49345] (1 protein) |
![]() | Protein Cytochrome domain of cellobiose dehydrogenase [49346] (1 species) |
![]() | Species Fungus (Phanerochaete chrysosporium) [TaxId:5306] [49347] (3 PDB entries) |
![]() | Domain d1d7ba_: 1d7b A: [22307] |
PDB Entry: 1d7b (more details), 1.9 Å
SCOP Domain Sequences for d1d7ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d7ba_ b.1.9.1 (A:) Cytochrome domain of cellobiose dehydrogenase {Fungus (Phanerochaete chrysosporium)} esasqftdpttgfqftgitdpvhdvtygfvfpplatsgaqstefigevvapiaskwigia lggamnndlllvawangnqivsstrwatgyvqptaytgtatlttlpettinsthwkwvfr cqgctewnngggidvtsqgvlawafsnvavddpsdpqstfsehtdfgffgidystahsan yqnyln
Timeline for d1d7ba_: