Lineage for d1d7ba_ (1d7b A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.9: Cytochrome domain of cellobiose dehydrogenase [49344] (1 family) 
Family b.1.9.1: Cytochrome domain of cellobiose dehydrogenase [49345] (1 protein) Protein Cytochrome domain of cellobiose dehydrogenase [49346] (1 species) Species Fungus (Phanerochaete chrysosporium) [TaxId:5306] [49347] (3 PDB entries) 
Domain d1d7ba_: 1d7b A: [22307]
Details for d1d7ba_
PDB Entry: 1d7b (more details), 1.9 Å
PDB Description: cytochrome domain of cellobiose dehydrogenase, ph 7.5
SCOP Domain Sequences for d1d7ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d7ba_ b.1.9.1 (A:) Cytochrome domain of cellobiose dehydrogenase {Fungus (Phanerochaete chrysosporium)}
esasqftdpttgfqftgitdpvhdvtygfvfpplatsgaqstefigevvapiaskwigia
lggamnndlllvawangnqivsstrwatgyvqptaytgtatlttlpettinsthwkwvfr
cqgctewnngggidvtsqgvlawafsnvavddpsdpqstfsehtdfgffgidystahsan
yqnyln
SCOP Domain Coordinates for d1d7ba_:
Click to download the PDB-style file with coordinates for d1d7ba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d7ba_:
- d1d7ba_ appears in SCOP 1.57
- d1d7ba_ appears in the current release, SCOPe 2.08
View in 3D
