Lineage for d1do5d_ (1do5 D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2031006Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2031007Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 protein domains)
  6. 2031008Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species)
  7. 2031015Species Human (Homo sapiens) [TaxId:9606] [49343] (1 PDB entry)
  8. 2031019Domain d1do5d_: 1do5 D: [22306]
    complexed with zn

Details for d1do5d_

PDB Entry: 1do5 (more details), 2.75 Å

PDB Description: human copper chaperone for superoxide dismutase domain ii
PDB Compounds: (D:) human copper chaperone for superoxide dismutase domain II

SCOPe Domain Sequences for d1do5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1do5d_ b.1.8.1 (D:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnsc
gnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidege
ddlgrgghplskitgnsgerlacgiiarsaglf

SCOPe Domain Coordinates for d1do5d_:

Click to download the PDB-style file with coordinates for d1do5d_.
(The format of our PDB-style files is described here.)

Timeline for d1do5d_: