| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
| Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
| Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49343] (4 PDB entries) |
| Domain d1do5c_: 1do5 C: [22305] complexed with zn |
PDB Entry: 1do5 (more details), 2.75 Å
SCOPe Domain Sequences for d1do5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1do5c_ b.1.8.1 (C:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnscgn
hfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidegedd
lgrgghplskitgnsgerlacgiiarsa
Timeline for d1do5c_: