Lineage for d4i9hh1 (4i9h H:1-159)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1829377Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1829746Protein automated matches [226881] (5 species)
    not a true protein
  7. 1829775Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (5 PDB entries)
  8. 1829783Domain d4i9hh1: 4i9h H:1-159 [223048]
    Other proteins in same PDB: d4i9ha2, d4i9hb2, d4i9hc2, d4i9hd2, d4i9he2, d4i9hf2, d4i9hg2, d4i9hh2
    automated match to d9ldta1
    complexed with 1e4

Details for d4i9hh1

PDB Entry: 4i9h (more details), 2.17 Å

PDB Description: Crystal structure of rabbit LDHA in complex with AP28669
PDB Compounds: (H:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4i9hh1:

Sequence, based on SEQRES records: (download)

>d4i9hh1 c.2.1.5 (H:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records): (download)

>d4i9hh1 c.2.1.5 (H:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqesrlnlvqrnvnifkfiipn
vvkysphckllvvsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d4i9hh1:

Click to download the PDB-style file with coordinates for d4i9hh1.
(The format of our PDB-style files is described here.)

Timeline for d4i9hh1: