| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein automated matches [226881] (8 species) not a true protein |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (6 PDB entries) |
| Domain d4i9hf1: 4i9h F:1-159 [223044] Other proteins in same PDB: d4i9ha2, d4i9hb2, d4i9hc2, d4i9hd2, d4i9he2, d4i9hf2, d4i9hg2, d4i9hh2 automated match to d9ldta1 complexed with 1e4 |
PDB Entry: 4i9h (more details), 2.17 Å
SCOPe Domain Sequences for d4i9hf1:
Sequence, based on SEQRES records: (download)
>d4i9hf1 c.2.1.5 (F:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig
>d4i9hf1 c.2.1.5 (F:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkevpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkgemm
dlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfiipn
vvkysphckllvvsnpvdiltyvawkisgfpknrvig
Timeline for d4i9hf1: