Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49343] (1 PDB entry) |
Domain d1do5b_: 1do5 B: [22304] complexed with zn |
PDB Entry: 1do5 (more details), 2.75 Å
SCOPe Domain Sequences for d1do5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1do5b_ b.1.8.1 (B:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} gaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnscgn hfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidegedd lgrgghplskitgnsgerlacgiiarsa
Timeline for d1do5b_: