Lineage for d1do5a_ (1do5 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10106Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 10107Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 10108Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species)
  7. 10113Species Human (Homo sapiens) [TaxId:9606] [49343] (1 PDB entry)
  8. 10114Domain d1do5a_: 1do5 A: [22303]

Details for d1do5a_

PDB Entry: 1do5 (more details), 2.75 Å

PDB Description: human copper chaperone for superoxide dismutase domain ii

SCOP Domain Sequences for d1do5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens)}
qnlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncns
cgnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliideg
eddlgrgghplskitgnsgerlacgiiarsaglf

SCOP Domain Coordinates for d1do5a_:

Click to download the PDB-style file with coordinates for d1do5a_.
(The format of our PDB-style files is described here.)

Timeline for d1do5a_: