Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (59 species) not a true protein |
Species Maize (Zea mays) [TaxId:4577] [226595] (4 PDB entries) |
Domain d4i8pa_: 4i8p A: [223012] automated match to d3iwja_ complexed with edo, gol, na, nad, peg |
PDB Entry: 4i8p (more details), 1.95 Å
SCOPe Domain Sequences for d4i8pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i8pa_ c.82.1.0 (A:) automated matches {Maize (Zea mays) [TaxId: 4577]} mvplrqlfvdgewrppaqgrrlpvvnptteahigeipagtaedvdaavaaaraalkrnrg rdwarapgavrakylraiaakvierkpelaklealdcgkpydeaawdmddvagcfeyfad qaealdkrqnspvslpmetfkchlrrepigvvglitpwnypllmatwkiapalaagctav lkpselasvtcleladickevglpsgvlnivtglgpdagaplsahpdvdkvaftgsfetg kkimasaapmvkpvtlelggkspivvfddvdidkavewtlfgcfwtngqicsatsrllih tkiakkfnermvawaknikvsdpleegcrlgpvvsegqyekikkfisnaksqgatiltgg vrpahlekgffieptiitdittsmeiwreevfgpvlcvkefstedeaielandtqyglag avisgdrercqrlseeidagciwvncsqpcfcqapwggnkrsgfgrelgeggidnylsvk qvteyisdepwgwyqspskl
Timeline for d4i8pa_: