Lineage for d4i8cc_ (4i8c C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914454Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 2914459Species Escherichia coli [TaxId:562] [102695] (28 PDB entries)
  8. 2914505Domain d4i8cc_: 4i8c C: [223011]
    automated match to d1zlqa1
    complexed with act, cl, gol, his, ni, so4

    has additional subdomain(s) that are not in the common domain

Details for d4i8cc_

PDB Entry: 4i8c (more details), 2.5 Å

PDB Description: X-ray structure of NikA in complex with Ni-(L-His)2
PDB Compounds: (C:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d4i8cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i8cc_ c.94.1.1 (C:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
deittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgktw
tftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitlk
sayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrnen
ywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtqls
qpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyanl
glkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqad
mrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaqq
gladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgni
pyapiateipfeqikp

SCOPe Domain Coordinates for d4i8cc_:

Click to download the PDB-style file with coordinates for d4i8cc_.
(The format of our PDB-style files is described here.)

Timeline for d4i8cc_: