SCOP 1.67: Domain d1qupa1: 1qup A:74-222

Lineage for d1qupa1 (1qup A:74-222)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49342] (3 PDB entries)

8. Domain d1qupa1: 1qup A:74-222 [22301]
   Other proteins in same PDB: d1qupa2, d1qupb2

Details for d1qupa1

PDB Entry: 1qup, 1.8 Å

PDB Description: crystal structure of the copper chaperone for superoxide dismutase

SCOP Domain Sequences for d1qupa1:

Sequence; same for both SEQRES and ATOM records:

>d1qupa1 b.1.8.1 (A:74-222) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
gkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvngvpeagnyhasi
hekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplptwqligrsfvis
kslnhpenepssvkdysflgviarsagvw

Timeline for d1qupa1:

• d1qupa1 first appeared (with stable ids) in SCOP 1.55
  
• d1qupa1 appears in SCOP 1.65
  
• d1qupa1 appears in SCOP 1.69
  
• d1qupa1 appears in the current release, SCOPe 2.08