![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) |
![]() | Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49342] (3 PDB entries) |
![]() | Domain d1qupa1: 1qup A:74-222 [22301] Other proteins in same PDB: d1qupa2, d1qupb2 |
PDB Entry: 1qup (more details), 1.8 Å
SCOP Domain Sequences for d1qupa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qupa1 b.1.8.1 (A:74-222) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} gkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvngvpeagnyhasi hekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplptwqligrsfvis kslnhpenepssvkdysflgviarsagvw
Timeline for d1qupa1: