SCOPe 2.06: Domain d4i82a_: 4i82 A:

Lineage for d4i82a_ (4i82 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (36 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [226558] (5 PDB entries)

8. Domain d4i82a_: 4i82 A: [223007]
   automated match to d1wlua_

Details for d4i82a_

PDB Entry: 4i82, 2.5 Å

PDB Description: crystal structure of hypothetical thioesterase protein sp_1851 from streptococcus pneumoniae tigr4

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d4i82a_:

Sequence; same for both SEQRES and ATOM records:

>d4i82a_ d.38.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
hfdaisafenyeiekmrdghvvvttkvvnsslnyygnahggylftlcdqisglvvislgl
dgvtlqssinylkagklddvltikgecvhqgrttcvmdvditnqegrnvckatftmfvtg
q

Timeline for d4i82a_:

• d4i82a_ first appeared in SCOPe 2.03
  
• d4i82a_ appears in SCOPe 2.05
  
• d4i82a_ appears in SCOPe 2.07
  
• d4i82a_ appears in the current release, SCOPe 2.08