SCOPe 2.08: Domain d1ej8a_: 1ej8 A:

Lineage for d1ej8a_ (1ej8 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49342] (3 PDB entries)

8. Domain d1ej8a_: 1ej8 A: [22300]
   second domain only
   complexed with ca

Details for d1ej8a_

PDB Entry: 1ej8, 1.55 Å

PDB Description: crystal structure of domain 2 of the yeast copper chaperone for superoxide dismutase (lys7) at 1.55 a resolution

PDB Compounds: (A:) lys7

SCOPe Domain Sequences for d1ej8a_:

Sequence; same for both SEQRES and ATOM records:

>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssavailetfqkytidqkkdtavrglarivqvgenktlfditvngvpeagnyhasihekg
dvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplptwqligrsfvisksln
hpenepssvkdysflgviar

Timeline for d1ej8a_:

• d1ej8a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ej8a_ appears in SCOPe 2.07