SCOPe 2.05: Domain d4i7pb_: 4i7p B:

Lineage for d4i7pb_ (4i7p B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (546 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d4i7pb_: 4i7p B: [222998]
   automated match to d3dkex_
   complexed with act, bme, es3, hed, so4

Details for d4i7pb_

PDB Entry: 4i7p, 1.6 Å

PDB Description: T4 Lysozyme L99A/M102H with 4-bromoimidazole bound

PDB Compounds: (B:) lysozyme

SCOPe Domain Sequences for d4i7pb_:

Sequence; same for both SEQRES and ATOM records:

>d4i7pb_ d.2.1.3 (B:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
ttenlyfqgsmnifemlrideglrlkiykdcegyytigighlltkspdlnaakseldkai
grncngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainhvfqmgvtg
vagftnvlrmlqqkrwdeaavnlaksrwynqcpdrakrvittfrtgtwdayknl

Timeline for d4i7pb_:

• d4i7pb_ first appeared in SCOPe 2.03
  
• d4i7pb_ appears in SCOPe 2.04
  
• d4i7pb_ is called d4i7pb1 in SCOPe 2.06
  
• d4i7pb_ appears in the current release, SCOPe 2.08, called d4i7pb1