Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.3: Phage lysozyme [53981] (4 proteins) |
Protein Phage T4 lysozyme [53982] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries) Uniprot P00720 many mutant structures |
Domain d4i7oa1: 4i7o A:1-164 [222995] Other proteins in same PDB: d4i7oa2, d4i7ob2 automated match to d3dkex_ complexed with 1dh, act, bme, hed, so4 |
PDB Entry: 4i7o (more details), 1.73 Å
SCOPe Domain Sequences for d4i7oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i7oa1 d.2.1.3 (A:1-164) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]} mnifemlrideglrlkiykdcegyytigighlltkspdlnaakseldkaigrncngvitk deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainhvfqmgvtgvagftnvlrm lqqkrwdeaavnlaksrwynqcpdrakrvittfrtgtwdayknl
Timeline for d4i7oa1: