SCOPe 2.08: Domain d4i7ma1: 4i7m A:1-164

Lineage for d4i7ma1 (4i7m A:1-164)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d4i7ma1: 4i7m A:1-164 [222991]
   Other proteins in same PDB: d4i7ma2, d4i7mb2
   automated match to d3dkex_
   complexed with 2lp, act, bme, hed, so4

Details for d4i7ma1

PDB Entry: 4i7m, 1.48 Å

PDB Description: t4 lysozyme l99a/m102h with 2-allylphenol bound

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d4i7ma1:

Sequence; same for both SEQRES and ATOM records:

>d4i7ma1 d.2.1.3 (A:1-164) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdcegyytigighlltkspdlnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainhvfqmgvtgvagftnvlrm
lqqkrwdeaavnlaksrwynqcpdrakrvittfrtgtwdayknl

Timeline for d4i7ma1:

• d4i7ma1 first appeared in SCOPe 2.03, called d4i7ma_
  
• d4i7ma1 appears in SCOPe 2.07