| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
| Family d.2.1.3: Phage lysozyme [53981] (4 proteins) |
| Protein Phage T4 lysozyme [53982] (1 species) |
| Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries) Uniprot P00720 many mutant structures |
| Domain d4i7lb1: 4i7l B:1-164 [222990] Other proteins in same PDB: d4i7la2, d4i7lb2 automated match to d3dkex_ complexed with act, bme, hed, iph, so4 |
PDB Entry: 4i7l (more details), 1.52 Å
SCOPe Domain Sequences for d4i7lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i7lb1 d.2.1.3 (B:1-164) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdcegyytigighlltkspdlnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainhvfqmgvtgvagftnvlrm
lqqkrwdeaavnlaksrwynqcpdrakrvittfrtgtwdayknl
Timeline for d4i7lb1: