SCOPe 2.07: Domain d4i7lb1: 4i7l B:1-164

Lineage for d4i7lb1 (4i7l B:1-164)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 protein domains)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (572 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d4i7lb1: 4i7l B:1-164 [222990]
   Other proteins in same PDB: d4i7la2, d4i7lb2
   automated match to d3dkex_
   complexed with act, bme, hed, iph, so4

Details for d4i7lb1

PDB Entry: 4i7l, 1.52 Å

PDB Description: T4 Lysozyme L99A/M102H with phenol bound

PDB Compounds: (B:) lysozyme

SCOPe Domain Sequences for d4i7lb1:

Sequence; same for both SEQRES and ATOM records:

>d4i7lb1 d.2.1.3 (B:1-164) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdcegyytigighlltkspdlnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainhvfqmgvtgvagftnvlrm
lqqkrwdeaavnlaksrwynqcpdrakrvittfrtgtwdayknl

Timeline for d4i7lb1:

• d4i7lb1 first appeared in SCOPe 2.03, called d4i7lb_
  
• d4i7lb1 appears in SCOPe 2.06