Lineage for d2apsb_ (2aps B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) 
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species) 
Species Actinobacillus pleuropneumoniae [TaxId:715] [49340] (1 PDB entry) 
Domain d2apsb_: 2aps B: [22299]
Details for d2apsb_
PDB Entry: 2aps (more details), 1.9 Å
PDB Description: cu/zn superoxide dismutase from actinobacillus pleuropneumoniae
SCOP Domain Sequences for d2apsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2apsb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae}
eklvvqvqqldpvkgnkdvgtveitesayglvftphlhglaqglhgfhihqnpscepkek
dgklvaglgagghwdpketkqhgypwsdnahlgdlpalfvehdgsatnpvlaprlkklde
vkghslmiheggdnhsdhpaplggggprmacgvik
SCOP Domain Coordinates for d2apsb_:
Click to download the PDB-style file with coordinates for d2apsb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2apsb_:
- d2apsb_ appears in SCOP 1.57
- d2apsb_ appears in the current release, SCOPe 2.08
View in 3D
