Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.70: Nucleoside hydrolase [53589] (1 superfamily) core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest |
Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) |
Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins) automatically mapped to Pfam PF01156 |
Protein automated matches [190287] (4 species) not a true protein |
Species Trypanosoma brucei [TaxId:999953] [226742] (6 PDB entries) |
Domain d4i75b_: 4i75 B: [222980] Other proteins in same PDB: d4i75a2 automated match to d1hoza_ complexed with ca, ni, trs |
PDB Entry: 4i75 (more details), 1.8 Å
SCOPe Domain Sequences for d4i75b_:
Sequence, based on SEQRES records: (download)
>d4i75b_ c.70.1.1 (B:) automated matches {Trypanosoma brucei [TaxId: 999953]} maktvildhdgnkddfvamilllsnpkkvnligcictdadcfvengfdvtgkimcamhrl iktplfpigkstatavnafptewrfsaknlddmpflnivedvalweklkpeneahngqql ladlvmkskekvtvcvtgplsnmawciekygeaftskveecvimggavdvggnvflpttd gsaewniywdppaakkvlccpnircvlfsldatntvpvrsvdvkgfgaqnqyllsqmvgt mwamstheeilrdgdayyawdaltaayileptiatlepvaldvdvskgksegrtprasge gkpcvhvarnpskqmfhdlvfastrvc
>d4i75b_ c.70.1.1 (B:) automated matches {Trypanosoma brucei [TaxId: 999953]} maktvildhdgnkddfvamilllsnpkkvnligcictdadcfvengfdvtgkimcamhrl iktplfpigkstatavnafptewrfsaknlddmpflnivedvalweklkpeneahngqql ladlvmkskekvtvcvtgplsnmawciekygeaftskveecvimggavdvggnvflpttd gsaewniywdppaakkvlccpnircvlfsldatntvpvrsvdvkgfgaqnqyllsqmvgt mwamstheeilrdgdayyawdaltaayileptiatlepvaldvdvskgksegrtprapcv hvarnpskqmfhdlvfastrvc
Timeline for d4i75b_: