Lineage for d4i75b_ (4i75 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136733Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2136734Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2136735Family c.70.1.1: Nucleoside hydrolase [53591] (5 protein domains)
    automatically mapped to Pfam PF01156
  6. 2136776Protein automated matches [190287] (3 species)
    not a true protein
  7. 2136777Species Trypanosoma brucei [TaxId:999953] [226742] (6 PDB entries)
  8. 2136782Domain d4i75b_: 4i75 B: [222980]
    Other proteins in same PDB: d4i75a2
    automated match to d1hoza_
    complexed with ca, ni, trs

Details for d4i75b_

PDB Entry: 4i75 (more details), 1.8 Å

PDB Description: Crystal structure of the Trypanosoma brucei Inosine-Adenosine-Guanosine nucleoside hydrolase in complex with the NiTris metalorganic complex
PDB Compounds: (B:) Inosine-adenosine-guanosine-nucleoside hydrolase

SCOPe Domain Sequences for d4i75b_:

Sequence, based on SEQRES records: (download)

>d4i75b_ c.70.1.1 (B:) automated matches {Trypanosoma brucei [TaxId: 999953]}
maktvildhdgnkddfvamilllsnpkkvnligcictdadcfvengfdvtgkimcamhrl
iktplfpigkstatavnafptewrfsaknlddmpflnivedvalweklkpeneahngqql
ladlvmkskekvtvcvtgplsnmawciekygeaftskveecvimggavdvggnvflpttd
gsaewniywdppaakkvlccpnircvlfsldatntvpvrsvdvkgfgaqnqyllsqmvgt
mwamstheeilrdgdayyawdaltaayileptiatlepvaldvdvskgksegrtprasge
gkpcvhvarnpskqmfhdlvfastrvc

Sequence, based on observed residues (ATOM records): (download)

>d4i75b_ c.70.1.1 (B:) automated matches {Trypanosoma brucei [TaxId: 999953]}
maktvildhdgnkddfvamilllsnpkkvnligcictdadcfvengfdvtgkimcamhrl
iktplfpigkstatavnafptewrfsaknlddmpflnivedvalweklkpeneahngqql
ladlvmkskekvtvcvtgplsnmawciekygeaftskveecvimggavdvggnvflpttd
gsaewniywdppaakkvlccpnircvlfsldatntvpvrsvdvkgfgaqnqyllsqmvgt
mwamstheeilrdgdayyawdaltaayileptiatlepvaldvdvskgksegrtprapcv
hvarnpskqmfhdlvfastrvc

SCOPe Domain Coordinates for d4i75b_:

Click to download the PDB-style file with coordinates for d4i75b_.
(The format of our PDB-style files is described here.)

Timeline for d4i75b_: