SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4i75b_ (4i75 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136733Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2136734Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2136735Family c.70.1.1: Nucleoside hydrolase [53591] (5 protein domains)
    automatically mapped to Pfam PF01156
  6. 2136776Protein automated matches [190287] (2 species)
    not a true protein
  7. 2136777Species Trypanosoma brucei [TaxId:999953] [226742] (6 PDB entries)
  8. 2136782Domain d4i75b_: 4i75 B: [222980]
    Other proteins in same PDB: d4i75a2
    automated match to d1hoza_
    complexed with ca, ni, trs

Details for d4i75b_

PDB Entry: 4i75 (more details), 1.8 Å

PDB Description: Crystal structure of the Trypanosoma brucei Inosine-Adenosine-Guanosine nucleoside hydrolase in complex with the NiTris metalorganic complex
PDB Compounds: (B:) Inosine-adenosine-guanosine-nucleoside hydrolase

SCOPe Domain Sequences for d4i75b_:

Sequence, based on SEQRES records: (download)

>d4i75b_ c.70.1.1 (B:) automated matches {Trypanosoma brucei [TaxId: 999953]}
maktvildhdgnkddfvamilllsnpkkvnligcictdadcfvengfdvtgkimcamhrl
iktplfpigkstatavnafptewrfsaknlddmpflnivedvalweklkpeneahngqql
ladlvmkskekvtvcvtgplsnmawciekygeaftskveecvimggavdvggnvflpttd
gsaewniywdppaakkvlccpnircvlfsldatntvpvrsvdvkgfgaqnqyllsqmvgt
mwamstheeilrdgdayyawdaltaayileptiatlepvaldvdvskgksegrtprasge
gkpcvhvarnpskqmfhdlvfastrvc

Sequence, based on observed residues (ATOM records): (download)

>d4i75b_ c.70.1.1 (B:) automated matches {Trypanosoma brucei [TaxId: 999953]}
maktvildhdgnkddfvamilllsnpkkvnligcictdadcfvengfdvtgkimcamhrl
iktplfpigkstatavnafptewrfsaknlddmpflnivedvalweklkpeneahngqql
ladlvmkskekvtvcvtgplsnmawciekygeaftskveecvimggavdvggnvflpttd
gsaewniywdppaakkvlccpnircvlfsldatntvpvrsvdvkgfgaqnqyllsqmvgt
mwamstheeilrdgdayyawdaltaayileptiatlepvaldvdvskgksegrtprapcv
hvarnpskqmfhdlvfastrvc

SCOPe Domain Coordinates for d4i75b_:

Click to download the PDB-style file with coordinates for d4i75b_.
(The format of our PDB-style files is described here.)

Timeline for d4i75b_: