Lineage for d4i72a1 (4i72 A:1-327)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136733Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2136734Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2136735Family c.70.1.1: Nucleoside hydrolase [53591] (5 protein domains)
    automatically mapped to Pfam PF01156
  6. 2136776Protein automated matches [190287] (3 species)
    not a true protein
  7. 2136777Species Trypanosoma brucei [TaxId:999953] [226742] (6 PDB entries)
  8. 2136783Domain d4i72a1: 4i72 A:1-327 [222972]
    Other proteins in same PDB: d4i72a2, d4i72b2
    automated match to d1hoza_
    complexed with ca, ni, trs, ua2

Details for d4i72a1

PDB Entry: 4i72 (more details), 2.05 Å

PDB Description: Crystal structure of the Trypanosoma brucei Inosine-Adenosine-Guanosine nucleoside hydrolase in complex with Immucillin A
PDB Compounds: (A:) Inosine-adenosine-guanosine-nucleoside hydrolase

SCOPe Domain Sequences for d4i72a1:

Sequence, based on SEQRES records: (download)

>d4i72a1 c.70.1.1 (A:1-327) automated matches {Trypanosoma brucei [TaxId: 999953]}
maktvildhdgnkddfvamilllsnpkkvnligcictdadcfvengfdvtgkimcamhrl
iktplfpigkstatavnafptewrfsaknlddmpflnivedvalweklkpeneahngqql
ladlvmkskekvtvcvtgplsnmawciekygeaftskveecvimggavdvggnvflpttd
gsaewniywdppaakkvlccpnircvlfsldatntvpvrsvdvkgfgaqnqyllsqmvgt
mwamstheeilrdgdayyawdaltaayileptiatlepvaldvdvskgksegrtprasge
gkpcvhvarnpskqmfhdlvfastrvc

Sequence, based on observed residues (ATOM records): (download)

>d4i72a1 c.70.1.1 (A:1-327) automated matches {Trypanosoma brucei [TaxId: 999953]}
maktvildhdgnkddfvamilllsnpkkvnligcictdadcfvengfdvtgkimcamhrl
iktplfpigkstatavnafptewrfsaknlddmpflnivedvalweklkpeneahngqql
ladlvmkskekvtvcvtgplsnmawciekygeaftskveecvimggavdvggnvflpttd
gsaewniywdppaakkvlccpnircvlfsldatntvpvrsvdvkgfgaqnqyllsqmvgt
mwamstheeilrdgdayyawdaltaayileptiatlepvaldvdvskgksegrtprasgk
pcvhvarnpskqmfhdlvfastrvc

SCOPe Domain Coordinates for d4i72a1:

Click to download the PDB-style file with coordinates for d4i72a1.
(The format of our PDB-style files is described here.)

Timeline for d4i72a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i72a2