SCOPe 2.08: Domain d4i6yb2: 4i6y B:611-720

Lineage for d4i6yb2 (4i6y B:611-720)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family)

5. Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)

6. Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)

7. Species Pseudomonas mevalonii [TaxId:32044] [55039] (11 PDB entries)
   Uniprot P13702 4-377

8. Domain d4i6yb2: 4i6y B:611-720 [222969]
   Other proteins in same PDB: d4i6ya1, d4i6yb1
   automated match to d1r31a1
   complexed with gol, mev, no2, so4

Details for d4i6yb2

PDB Entry: 4i6y, 1.45 Å

PDB Description: 3-hydroxy-3-methyl (hmg) coenzyme a reductase bound to r-mevalonate

PDB Compounds: (B:) 3-hydroxy-3-methylglutaryl-coenzyme A reductase

SCOPe Domain Sequences for d4i6yb2:

Sequence; same for both SEQRES and ATOM records:

>d4i6yb2 d.58.20.1 (B:611-720) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg
pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl

Timeline for d4i6yb2:

• d4i6yb2 first appeared in SCOPe 2.03
  
• d4i6yb2 appears in SCOPe 2.07