Lineage for d4i6wb1 (4i6w B:503-610,B:721-878)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237465Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
    unusual fold
  4. 2237466Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 2237467Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 2237468Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 2237506Species Pseudomonas mevalonii [TaxId:32044] [56546] (11 PDB entries)
    Uniprot P13702 4-377
  8. 2237512Domain d4i6wb1: 4i6w B:503-610,B:721-878 [222964]
    Other proteins in same PDB: d4i6wa2, d4i6wb2
    automated match to d1r31a2
    complexed with 1co, gol, so4

Details for d4i6wb1

PDB Entry: 4i6w (more details), 1.66 Å

PDB Description: 3-hydroxy-3-methylglutaryl (hmg) coenzyme-a reductase complexed with thiomevalonate
PDB Compounds: (B:) 3-hydroxy-3-methylglutaryl-coenzyme A reductase

SCOPe Domain Sequences for d4i6wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i6wb1 d.179.1.1 (B:503-610,B:721-878) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
ldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpy
avasnfqingrdvlvplvveepsivaaasymaklaranggfttsssapXrlaraqvritp
qqletaefsgeaviegildayafaavdpyraathnkgimngidplivatgndwraveaga
hayacrsghygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaq
alaeiavavglaqnlgamralategiq

SCOPe Domain Coordinates for d4i6wb1:

Click to download the PDB-style file with coordinates for d4i6wb1.
(The format of our PDB-style files is described here.)

Timeline for d4i6wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i6wb2