SCOPe 2.08: Domain d4i6wb1: 4i6w B:503-610,B:721-878

Lineage for d4i6wb1 (4i6w B:503-610,B:721-878)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
   unusual fold

4. Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family)

5. Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)

6. Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)

7. Species Pseudomonas mevalonii [TaxId:32044] [56546] (11 PDB entries)
   Uniprot P13702 4-377

8. Domain d4i6wb1: 4i6w B:503-610,B:721-878 [222964]
   Other proteins in same PDB: d4i6wa2, d4i6wb2
   automated match to d1r31a2
   complexed with 1co, gol, so4

Details for d4i6wb1

PDB Entry: 4i6w, 1.66 Å

PDB Description: 3-hydroxy-3-methylglutaryl (hmg) coenzyme-a reductase complexed with thiomevalonate

PDB Compounds: (B:) 3-hydroxy-3-methylglutaryl-coenzyme A reductase

SCOPe Domain Sequences for d4i6wb1:

Sequence; same for both SEQRES and ATOM records:

>d4i6wb1 d.179.1.1 (B:503-610,B:721-878) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
ldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpy
avasnfqingrdvlvplvveepsivaaasymaklaranggfttsssapXrlaraqvritp
qqletaefsgeaviegildayafaavdpyraathnkgimngidplivatgndwraveaga
hayacrsghygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaq
alaeiavavglaqnlgamralategiq

Timeline for d4i6wb1:

• d4i6wb1 first appeared in SCOPe 2.03
  
• d4i6wb1 appears in SCOPe 2.07