Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily) unusual fold |
Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) |
Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein) |
Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species) |
Species Pseudomonas mevalonii [TaxId:32044] [56546] (11 PDB entries) Uniprot P13702 4-377 |
Domain d4i6wb1: 4i6w B:503-610,B:721-878 [222964] Other proteins in same PDB: d4i6wa2, d4i6wb2 automated match to d1r31a2 complexed with 1co, gol, so4 |
PDB Entry: 4i6w (more details), 1.66 Å
SCOPe Domain Sequences for d4i6wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i6wb1 d.179.1.1 (B:503-610,B:721-878) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]} ldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpy avasnfqingrdvlvplvveepsivaaasymaklaranggfttsssapXrlaraqvritp qqletaefsgeaviegildayafaavdpyraathnkgimngidplivatgndwraveaga hayacrsghygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaq alaeiavavglaqnlgamralategiq
Timeline for d4i6wb1: