Lineage for d4i6jc2 (4i6j C:85-162)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348494Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2348495Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2348496Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 2348523Protein automated matches [226933] (1 species)
    not a true protein
  7. 2348524Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries)
  8. 2348526Domain d4i6jc2: 4i6j C:85-162 [222960]
    Other proteins in same PDB: d4i6ja1, d4i6jc1
    automated match to d1p22b1

Details for d4i6jc2

PDB Entry: 4i6j (more details), 2.7 Å

PDB Description: A ubiquitin ligase-substrate complex
PDB Compounds: (C:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d4i6jc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i6jc2 a.157.1.1 (C:85-162) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqwcee

SCOPe Domain Coordinates for d4i6jc2:

Click to download the PDB-style file with coordinates for d4i6jc2.
(The format of our PDB-style files is described here.)

Timeline for d4i6jc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i6jc1
View in 3D
Domains from other chains:
(mouse over for more information)
d4i6ja1