SCOPe 2.08: Domain d1eqwc_: 1eqw C:

Lineage for d1eqwc_ (1eqw C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Salmonella typhimurium [TaxId:90371] [49339] (1 PDB entry)

8. Domain d1eqwc_: 1eqw C: [22296]
   complexed with cu, zn

Details for d1eqwc_

PDB Entry: 1eqw, 2.3 Å

PDB Description: crystal structure of salmonella typhimurium cu,zn superoxide dismutase

PDB Compounds: (C:) cu,zn superoxide dismutase

SCOPe Domain Sequences for d1eqwc_:

Sequence; same for both SEQRES and ATOM records:

>d1eqwc_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]}
ntltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgmk
dgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlkslse
lkghslmihkggdnysdkpaplggggarfacgvi

Timeline for d1eqwc_:

• d1eqwc_ first appeared (with stable ids) in SCOP 1.55
  
• d1eqwc_ appears in SCOPe 2.07