SCOPe 2.08: Domain d4i6aa2: 4i6a A:111-220

Lineage for d4i6aa2 (4i6a A:111-220)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family)

5. Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)

6. Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)

7. Species Pseudomonas mevalonii [TaxId:32044] [55039] (11 PDB entries)
   Uniprot P13702 4-377

8. Domain d4i6aa2: 4i6a A:111-220 [222954]
   Other proteins in same PDB: d4i6aa1, d4i6ab1
   automated match to d1r31a1
   complexed with hmg, so4

Details for d4i6aa2

PDB Entry: 4i6a, 1.85 Å

PDB Description: 3-hydroxy-3-methylglutaryl (hmg) coenzyme a reductase from pseudomonas mevalonii complexed with hmg-coa

PDB Compounds: (A:) 3-hydroxy-3-methylglutaryl-coenzyme A reductase

SCOPe Domain Sequences for d4i6aa2:

Sequence; same for both SEQRES and ATOM records:

>d4i6aa2 d.58.20.1 (A:111-220) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg
pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl

Timeline for d4i6aa2:

• d4i6aa2 first appeared in SCOPe 2.03
  
• d4i6aa2 appears in SCOPe 2.07