Class b: All beta proteins [48724] (174 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein automated matches [190191] (2 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [186931] (22 PDB entries) |
Domain d4i60a_: 4i60 A: [222948] automated match to d1wbia_ complexed with b1r |
PDB Entry: 4i60 (more details), 2.5 Å
SCOPe Domain Sequences for d4i60a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i60a_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} arkcsltgkwtndlgsnmtigavnskgeftgtyttavtatsneikesplhgtqntinkrt qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif trlrtqke
Timeline for d4i60a_: