Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) |
Family a.118.1.2: HEAT repeat [48385] (3 proteins) Pfam PF02985 this is a repeat family; one repeat unit is 1b3u A:295-335 found in domain |
Protein Constant regulatory domain of protein phosphatase 2a, pr65alpha [48386] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48387] (12 PDB entries) |
Domain d4i5na1: 4i5n A:9-589 [222944] Other proteins in same PDB: d4i5na2, d4i5nc_, d4i5nd2, d4i5nf_ automated match to d4i5la_ complexed with ca, mn |
PDB Entry: 4i5n (more details), 2.8 Å
SCOPe Domain Sequences for d4i5na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i5na1 a.118.1.2 (A:9-589) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} slypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiydedevlla laeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehspsdleahf vplvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmvrraaask lgefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedlealvmptl rqaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraaashkvke fcenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdntiehllpl flaqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrlaiieymp llagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahatiipkvla msgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnvakslqkig pildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla
Timeline for d4i5na1:
View in 3D Domains from other chains: (mouse over for more information) d4i5nc_, d4i5nd1, d4i5nd2, d4i5nf_ |