Lineage for d4i5ha_ (4i5h A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673984Protein automated matches [190091] (13 species)
    not a true protein
  7. 1674812Species Norway rat (Rattus norvegicus) [TaxId:10116] [226719] (1 PDB entry)
  8. 1674813Domain d4i5ha_: 4i5h A: [222943]
    automated match to d3r63a_
    complexed with g17; mutant

Details for d4i5ha_

PDB Entry: 4i5h (more details), 1.9 Å

PDB Description: Crystal Structure of a Double Mutant Rat Erk2 Complexed With a Type II Quinazoline Inhibitor
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d4i5ha_:

Sequence, based on SEQRES records: (download)

>d4i5ha_ d.144.1.7 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivadlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkildfglarvadpdhdhtgflteyvat
rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgy

Sequence, based on observed residues (ATOM records): (download)

>d4i5ha_ d.144.1.7 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivadlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkildfglarvadplteyvatrwyrape
imlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnciin
lkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleqyy
dpsdepiaeapfkdlpkeklkelifeetarfqpgy

SCOPe Domain Coordinates for d4i5ha_:

Click to download the PDB-style file with coordinates for d4i5ha_.
(The format of our PDB-style files is described here.)

Timeline for d4i5ha_: