Lineage for d1eqwa_ (1eqw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2763729Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2764355Species Salmonella typhimurium [TaxId:90371] [49339] (1 PDB entry)
  8. 2764356Domain d1eqwa_: 1eqw A: [22294]
    complexed with cu, zn

Details for d1eqwa_

PDB Entry: 1eqw (more details), 2.3 Å

PDB Description: crystal structure of salmonella typhimurium cu,zn superoxide dismutase
PDB Compounds: (A:) cu,zn superoxide dismutase

SCOPe Domain Sequences for d1eqwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]}
ntltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgmk
dgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlkslse
lkghslmihkggdnysdkpaplggggarfacgvie

SCOPe Domain Coordinates for d1eqwa_:

Click to download the PDB-style file with coordinates for d1eqwa_.
(The format of our PDB-style files is described here.)

Timeline for d1eqwa_: