Lineage for d4i5de1 (4i5d E:2-249)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848266Species Ralstonia sp. [TaxId:517192] [197315] (6 PDB entries)
  8. 2848275Domain d4i5de1: 4i5d E:2-249 [222939]
    Other proteins in same PDB: d4i5da2, d4i5db2, d4i5dc2, d4i5dd2, d4i5de2, d4i5df2, d4i5dg2, d4i5dh2
    automated match to d4i5ea_
    complexed with so4

Details for d4i5de1

PDB Entry: 4i5d (more details), 2.4 Å

PDB Description: Crystal structure of Ralstonia sp. alcohol dehydrogenase in its apo form
PDB Compounds: (E:) Alclohol dehydrogenase/short-chain dehydrogenase

SCOPe Domain Sequences for d4i5de1:

Sequence, based on SEQRES records: (download)

>d4i5de1 c.2.1.0 (E:2-249) automated matches {Ralstonia sp. [TaxId: 517192]}
yrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkadv
tkledldrlyaivreqrgsidvlfansgaieqktleeitpehydrtfdvnvrgliftvqk
alpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavspg
aidtpiienqvstqeeadelrakfaaatplgrvgrpeelaaavlflasddssyvagielf
vdggltqv

Sequence, based on observed residues (ATOM records): (download)

>d4i5de1 c.2.1.0 (E:2-249) automated matches {Ralstonia sp. [TaxId: 517192]}
yrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkadv
tkledldrlyaivreqrgsidvlfansgaieqktleeitpehydrtfdvnvrgliftvqk
alpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavspg
aidtpakfaaatplgrvgrpeelaaavlflasddssyvagielfvdggltqv

SCOPe Domain Coordinates for d4i5de1:

Click to download the PDB-style file with coordinates for d4i5de1.
(The format of our PDB-style files is described here.)

Timeline for d4i5de1: