Lineage for d4i5dc1 (4i5d C:2-249)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095774Species Ralstonia sp. [TaxId:517192] [197315] (6 PDB entries)
  8. 2095789Domain d4i5dc1: 4i5d C:2-249 [222937]
    Other proteins in same PDB: d4i5da2, d4i5db2, d4i5dc2, d4i5dd2, d4i5de2, d4i5df2, d4i5dg2, d4i5dh2
    automated match to d4i5ea_
    complexed with so4

Details for d4i5dc1

PDB Entry: 4i5d (more details), 2.4 Å

PDB Description: Crystal structure of Ralstonia sp. alcohol dehydrogenase in its apo form
PDB Compounds: (C:) Alclohol dehydrogenase/short-chain dehydrogenase

SCOPe Domain Sequences for d4i5dc1:

Sequence, based on SEQRES records: (download)

>d4i5dc1 c.2.1.0 (C:2-249) automated matches {Ralstonia sp. [TaxId: 517192]}
yrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkadv
tkledldrlyaivreqrgsidvlfansgaieqktleeitpehydrtfdvnvrgliftvqk
alpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavspg
aidtpiienqvstqeeadelrakfaaatplgrvgrpeelaaavlflasddssyvagielf
vdggltqv

Sequence, based on observed residues (ATOM records): (download)

>d4i5dc1 c.2.1.0 (C:2-249) automated matches {Ralstonia sp. [TaxId: 517192]}
yrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkadv
tkledldrlyaivreqrgsidvlfansgaieqktleeitpehydrtfdvnvrgliftvqk
alpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavspg
aidtpakfaaatplgrvgrpeelaaavlflasddssyvagielfvdggltqv

SCOPe Domain Coordinates for d4i5dc1:

Click to download the PDB-style file with coordinates for d4i5dc1.
(The format of our PDB-style files is described here.)

Timeline for d4i5dc1: