Lineage for d4i56b1 (4i56 B:503-610,B:721-878)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237465Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
    unusual fold
  4. 2237466Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 2237467Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 2237468Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 2237506Species Pseudomonas mevalonii [TaxId:32044] [56546] (11 PDB entries)
    Uniprot P13702 4-377
  8. 2237510Domain d4i56b1: 4i56 B:503-610,B:721-878 [222932]
    Other proteins in same PDB: d4i56a2, d4i56b2
    automated match to d1r31a2
    complexed with 1cz, gol, so4

Details for d4i56b1

PDB Entry: 4i56 (more details), 1.5 Å

PDB Description: hmg-coa reductase from pseudomonas mevalonii complexed with dithio- hmg-coa
PDB Compounds: (B:) 3-hydroxy-3-methylglutaryl-coenzyme A reductase

SCOPe Domain Sequences for d4i56b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i56b1 d.179.1.1 (B:503-610,B:721-878) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
ldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpy
avasnfqingrdvlvplvveepsivaaasymaklaranggfttsssapXrlaraqvritp
qqletaefsgeaviegildayafaavdpyraathnkgimngidplivatgndwraveaga
hayacrsghygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaq
alaeiavavglaqnlgamralategiq

SCOPe Domain Coordinates for d4i56b1:

Click to download the PDB-style file with coordinates for d4i56b1.
(The format of our PDB-style files is described here.)

Timeline for d4i56b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i56b2