Lineage for d4i56a1 (4i56 A:3-110,A:221-375)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1444634Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
    unusual fold
  4. 1444635Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 1444636Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 1444637Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 1444675Species Pseudomonas mevalonii [TaxId:32044] [56546] (11 PDB entries)
    Uniprot P13702 4-377
  8. 1444678Domain d4i56a1: 4i56 A:3-110,A:221-375 [222930]
    Other proteins in same PDB: d4i56a2, d4i56b2
    automated match to d1r31a2
    complexed with 1cz, gol, so4

Details for d4i56a1

PDB Entry: 4i56 (more details), 1.5 Å

PDB Description: hmg-coa reductase from pseudomonas mevalonii complexed with dithio- hmg-coa
PDB Compounds: (A:) 3-hydroxy-3-methylglutaryl-coenzyme A reductase

SCOPe Domain Sequences for d4i56a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i56a1 d.179.1.1 (A:3-110,A:221-375) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
ldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpy
avasnfqingrdvlvplvveepsivaaasymaklaranggfttsssapXrlaraqvritp
qqletaefsgeaviegildayafaavdpyraathnkgimngidplivatgndwraveaga
hayacrsghygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaq
alaeiavavglaqnlgamralate

SCOPe Domain Coordinates for d4i56a1:

Click to download the PDB-style file with coordinates for d4i56a1.
(The format of our PDB-style files is described here.)

Timeline for d4i56a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i56a2