Lineage for d1eso__ (1eso -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 55083Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 55084Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 55097Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 55151Species Escherichia coli [TaxId:562] [49338] (1 PDB entry)
  8. 55152Domain d1eso__: 1eso - [22293]

Details for d1eso__

PDB Entry: 1eso (more details), 2 Å

PDB Description: monomeric cu,zn superoxide dismutase from escherichia coli

SCOP Domain Sequences for d1eso__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eso__ b.1.8.1 (-) Cu,Zn superoxide dismutase, SOD {Escherichia coli}
asekvemnlvtsqgvgqsigsvtitetdkglefspdlkalppgehgfhihakgscqpatk
dgkasaaesagghldpqntgkhegpegaghlgdlpalvvnndgkatdaviaprlksldei
kdkalmvhvggdnmsdqpkplggggeryacgvik

SCOP Domain Coordinates for d1eso__:

Click to download the PDB-style file with coordinates for d1eso__.
(The format of our PDB-style files is described here.)

Timeline for d1eso__: