Lineage for d1eso__ (1eso -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) 
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species) 
Species Escherichia coli [TaxId:562] [49338] (1 PDB entry) 
Domain d1eso__: 1eso - [22293]
Details for d1eso__
PDB Entry: 1eso (more details), 2 Å
PDB Description: monomeric cu,zn superoxide dismutase from escherichia coli
SCOP Domain Sequences for d1eso__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eso__ b.1.8.1 (-) Cu,Zn superoxide dismutase, SOD {Escherichia coli}
asekvemnlvtsqgvgqsigsvtitetdkglefspdlkalppgehgfhihakgscqpatk
dgkasaaesagghldpqntgkhegpegaghlgdlpalvvnndgkatdaviaprlksldei
kdkalmvhvggdnmsdqpkplggggeryacgvik
SCOP Domain Coordinates for d1eso__:
Click to download the PDB-style file with coordinates for d1eso__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eso__:
- d1eso__ first appeared (with stable ids) in SCOP 1.55
- d1eso__ appears in SCOP 1.59
- d1eso__ appears in the current release, SCOPe 2.08, called d1esoa_
View in 3D