SCOPe 2.08: Domain d1esoa_: 1eso A:

Lineage for d1esoa_ (1eso A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Escherichia coli [TaxId:562] [49338] (1 PDB entry)
   Monomeric enzyme

8. Domain d1esoa_: 1eso A: [22293]
   complexed with cu, zn

Details for d1esoa_

PDB Entry: 1eso, 2 Å

PDB Description: monomeric cu,zn superoxide dismutase from escherichia coli

PDB Compounds: (A:) cu, zn superoxide dismutase

SCOPe Domain Sequences for d1esoa_:

Sequence; same for both SEQRES and ATOM records:

>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]}
asekvemnlvtsqgvgqsigsvtitetdkglefspdlkalppgehgfhihakgscqpatk
dgkasaaesagghldpqntgkhegpegaghlgdlpalvvnndgkatdaviaprlksldei
kdkalmvhvggdnmsdqpkplggggeryacgvik

Timeline for d1esoa_:

• d1esoa_ first appeared (with stable ids) in SCOP 1.55, called d1eso__
  
• d1esoa_ appears in SCOPe 2.07