Lineage for d1bzoa_ (1bzo A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367295Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 367296Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 367309Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 367493Species Photobacterium leiognathi [49337] (9 PDB entries)
  8. 367502Domain d1bzoa_: 1bzo A: [22292]
    complexed with cu, ium, zn; mutant

Details for d1bzoa_

PDB Entry: 1bzo (more details), 2.1 Å

PDB Description: three-dimensional structure of prokaryotic cu,zn superoxide dismutase from p.leiognathi, solved by x-ray crystallography.

SCOP Domain Sequences for d1bzoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi}
qdltvkmtdlqtgkpvgtielsqnkygvvfipeladltpgmhgfhihqngscassekdgk
vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
aimihaggdnhsdmpkalggggarvacgviq

SCOP Domain Coordinates for d1bzoa_:

Click to download the PDB-style file with coordinates for d1bzoa_.
(The format of our PDB-style files is described here.)

Timeline for d1bzoa_: