Lineage for d1bzoa_ (1bzo A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) 
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species) 
Species Photobacterium leiognathi [49337] (2 PDB entries) 
Domain d1bzoa_: 1bzo A: [22292]
Details for d1bzoa_
PDB Entry: 1bzo (more details), 2.1 Å
PDB Description: three-dimensional structure of prokaryotic cu,zn superoxide dismutase from p.leiognathi, solved by x-ray crystallography.
SCOP Domain Sequences for d1bzoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi}
qdltvkmtdlqtgkpvgtielsqnkygvvfipeladltpgmhgfhihqngscassekdgk
vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
aimihaggdnhsdmpkalggggarvacgviq
SCOP Domain Coordinates for d1bzoa_:
Click to download the PDB-style file with coordinates for d1bzoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bzoa_:
- d1bzoa_ appears in SCOP 1.57
- d1bzoa_ appears in the current release, SCOPe 2.08
View in 3D