SCOPe 2.07: Domain d4i50b2: 4i50 B:246-440

Lineage for d4i50b2 (4i50 B:246-440)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)

8. Domain d4i50b2: 4i50 B:246-440 [222917]
   Other proteins in same PDB: d4i50a1, d4i50b1, d4i50c1, d4i50d1, d4i50e_, d4i50f1, d4i50f2, d4i50f3
   automated match to d1jffb2
   complexed with acp, ca, cl, ep, gdp, gol, gtp, mes, mg

Details for d4i50b2

PDB Entry: 4i50, 2.3 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-epothilone a complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4i50b2:

Sequence, based on SEQRES records:

>d4i50b2 d.79.2.1 (B:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdata

Sequence, based on observed residues (ATOM records):

>d4i50b2 d.79.2.1 (B:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrltvpeltqqmfdsknmmaacdprhgry
ltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfign
staiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdata

Timeline for d4i50b2:

• d4i50b2 first appeared in SCOPe 2.03
  
• d4i50b2 appears in SCOPe 2.06
  
• d4i50b2 appears in the current release, SCOPe 2.08