SCOPe 2.03: Domain d4i50b1: 4i50 B:2-245

Lineage for d4i50b1 (4i50 B:2-245)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (11 PDB entries)

8. Domain d4i50b1: 4i50 B:2-245 [222916]
   Other proteins in same PDB: d4i50a2, d4i50b2, d4i50c2, d4i50d2, d4i50e_
   automated match to d1tubb1
   complexed with acp, ca, cl, ep, gdp, gol, gtp, mes, mg

Details for d4i50b1

PDB Entry: 4i50, 2.3 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-epothilone a complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4i50b1:

Sequence; same for both SEQRES and ATOM records:

>d4i50b1 c.32.1.1 (B:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d4i50b1:

• d4i50b1 is new in SCOPe 2.03-stable
  
• d4i50b1 appears in SCOPe 2.04
  
• d4i50b1 appears in the current release, SCOPe 2.08