| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein automated matches [227071] (2 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226565] (14 PDB entries) |
| Domain d4i4td2: 4i4t D:246-441 [222912] Other proteins in same PDB: d4i4ta1, d4i4tb1, d4i4tc1, d4i4td1, d4i4te_ automated match to d1jffb2 complexed with acp, ca, cl, gdp, gol, gtp, mes, mg, tyr, zpn |
PDB Entry: 4i4t (more details), 1.8 Å
SCOPe Domain Sequences for d4i4td2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i4td2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad
Timeline for d4i4td2: