| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (3 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226564] (14 PDB entries) |
| Domain d4i4td1: 4i4t D:1-245 [222911] Other proteins in same PDB: d4i4ta2, d4i4tb2, d4i4tc2, d4i4td2, d4i4te_ automated match to d1tubb1 complexed with acp, ca, cl, gdp, gol, gtp, mes, mg, tyr, zpn |
PDB Entry: 4i4t (more details), 1.8 Å
SCOPe Domain Sequences for d4i4td1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i4td1 c.32.1.1 (D:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp
Timeline for d4i4td1: