Lineage for d4i4tc2 (4i4t C:246-440)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525532Species Cow (Bos taurus) [TaxId:9913] [226565] (61 PDB entries)
  8. 2525539Domain d4i4tc2: 4i4t C:246-440 [222910]
    Other proteins in same PDB: d4i4ta1, d4i4tb1, d4i4tc1, d4i4td1, d4i4te_, d4i4tf1, d4i4tf2, d4i4tf3
    automated match to d1tuba2
    complexed with acp, ca, cl, gdp, gol, gtp, mes, mg, tyr, zpn

Details for d4i4tc2

PDB Entry: 4i4t (more details), 1.8 Å

PDB Description: crystal structure of tubulin-rb3-ttl-zampanolide complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4i4tc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i4tc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d4i4tc2:

Click to download the PDB-style file with coordinates for d4i4tc2.
(The format of our PDB-style files is described here.)

Timeline for d4i4tc2: