SCOPe 2.06: Domain d4i4tb1: 4i4t B:1-245

Lineage for d4i4tb1 (4i4t B:1-245)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (48 PDB entries)

8. Domain d4i4tb1: 4i4t B:1-245 [222907]
   Other proteins in same PDB: d4i4ta2, d4i4tb2, d4i4tc2, d4i4td2, d4i4te_, d4i4tf1, d4i4tf2, d4i4tf3
   automated match to d1tubb1
   complexed with acp, ca, cl, gdp, gol, gtp, mes, mg, tyr, zpn

Details for d4i4tb1

PDB Entry: 4i4t, 1.8 Å

PDB Description: crystal structure of tubulin-rb3-ttl-zampanolide complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4i4tb1:

Sequence; same for both SEQRES and ATOM records:

>d4i4tb1 c.32.1.1 (B:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d4i4tb1:

• d4i4tb1 first appeared in SCOPe 2.03
  
• d4i4tb1 appears in SCOPe 2.05
  
• d4i4tb1 appears in SCOPe 2.07
  
• d4i4tb1 appears in the current release, SCOPe 2.08