SCOPe 2.06: Domain d4i4ta2: 4i4t A:246-450

Lineage for d4i4ta2 (4i4t A:246-450)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (48 PDB entries)

8. Domain d4i4ta2: 4i4t A:246-450 [222906]
   Other proteins in same PDB: d4i4ta1, d4i4tb1, d4i4tc1, d4i4td1, d4i4te_, d4i4tf1, d4i4tf2, d4i4tf3
   automated match to d1tuba2
   complexed with acp, ca, cl, gdp, gol, gtp, mes, mg, tyr, zpn

Details for d4i4ta2

PDB Entry: 4i4t, 1.8 Å

PDB Description: crystal structure of tubulin-rb3-ttl-zampanolide complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4i4ta2:

Sequence, based on SEQRES records:

>d4i4ta2 d.79.2.1 (A:246-450) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsvegegeeegee

Sequence, based on observed residues (ATOM records):

>d4i4ta2 d.79.2.1 (A:246-450) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsvegeggee

Timeline for d4i4ta2:

• d4i4ta2 first appeared in SCOPe 2.03
  
• d4i4ta2 appears in SCOPe 2.05
  
• d4i4ta2 appears in SCOPe 2.07
  
• d4i4ta2 appears in the current release, SCOPe 2.08