SCOPe 2.03: Domain d4i4ic_: 4i4i C:

Lineage for d4i4ic_ (4i4i C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.89: Phosphofructokinase [53783] (1 superfamily)
   consists of two non-similar domains, 3 layers (a/b/a) each
   Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest
   Domain 2 has parallel sheet of 4 strands, order 2314

4. Superfamily c.89.1: Phosphofructokinase [53784] (2 families)

5. Family c.89.1.1: Phosphofructokinase [53785] (3 proteins)

6. Protein ATP-dependent phosphofructokinase [53786] (2 species)
   Domain 1 binds ATP

7. Species Bacillus stearothermophilus [TaxId:1422] [53788] (8 PDB entries)

8. Domain d4i4ic_: 4i4i C: [222903]
   automated match to d3u39b_
   complexed with pep; mutant

Details for d4i4ic_

PDB Entry: 4i4i, 2.49 Å

PDB Description: crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep

PDB Compounds: (C:) 6-phosphofructokinase

SCOPe Domain Sequences for d4i4ic_:

Sequence; same for both SEQRES and ATOM records:

>d4i4ic_ c.89.1.1 (C:) ATP-dependent phosphofructokinase {Bacillus stearothermophilus [TaxId: 1422]}
mkrigvltsggdspgmnaairsvvrkaiyhgvevygvyhgyagliagnikklevgdvgdi
ihrggtilytarcpefkteegqkkgieqlkkhgieglvviggdgsyqgakkltehgfpcv
gvpgtidndipgtdftigfdtalntvidaidkirdaatshertyvievmgrhagdialws
glaggaetilipeadydmndviarlkrghergkkhsiiivaegvgsgvdfgrqiqeatgf
etrvtvlghvqrggsptafdrvlasrlgaravelllegkggrcvgiqnnqlvdhdiaeal
ankhtidqrmyalskelsi

Timeline for d4i4ic_:

• d4i4ic_ is new in SCOPe 2.03-stable
  
• d4i4ic_ appears in SCOPe 2.04
  
• d4i4ic_ appears in the current release, SCOPe 2.08