Lineage for d4i4ea_ (4i4e A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2587950Protein Focal adhesion kinase 1 (fak) [103292] (2 species)
    PTK group; FAK subfamily; non-membrane spanning protein tyrosine kinase
  7. 2587954Species Human (Homo sapiens) [TaxId:9606] [103293] (23 PDB entries)
  8. 2587956Domain d4i4ea_: 4i4e A: [222899]
    automated match to d1mp8a_
    complexed with 1bq

Details for d4i4ea_

PDB Entry: 4i4e (more details), 1.55 Å

PDB Description: Structure of Focal Adhesion Kinase catalytic domain in complex with hinge binding pyrazolobenzothiazine compound.
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d4i4ea_:

Sequence, based on SEQRES records: (download)

>d4i4ea_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
dyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqeal
tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlsta
layleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwmapes
infrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlys
lmtkcwaydpsrrprftelkaqlstileeekaq

Sequence, based on observed residues (ATOM records): (download)

>d4i4ea_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
dyeiqrerielgrcigegqfgdvhqgiymspnpalavaiktcknctsdsvrekflqealt
mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstal
ayleskrfvhrdiaarnvlvssndcvklgdflpikwmapesinfrrftsasdvwmfgvcm
weilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrprftel
kaqlstileeekaq

SCOPe Domain Coordinates for d4i4ea_:

Click to download the PDB-style file with coordinates for d4i4ea_.
(The format of our PDB-style files is described here.)

Timeline for d4i4ea_: