Lineage for d4i4bb1 (4i4b B:503-610,B:721-878)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1943055Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
    unusual fold
  4. 1943056Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 1943057Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 1943058Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 1943096Species Pseudomonas mevalonii [TaxId:32044] [56546] (11 PDB entries)
    Uniprot P13702 4-377
  8. 1943104Domain d4i4bb1: 4i4b B:503-610,B:721-878 [222897]
    Other proteins in same PDB: d4i4ba2, d4i4bb2
    automated match to d1r31a2
    complexed with 1co, 1cv, gol, nad, so4

Details for d4i4bb1

PDB Entry: 4i4b (more details), 1.7 Å

PDB Description: hmg-coa reductase from pseudomonas mevalonii complexed with nad and intermediate hemiacetal form of hmg-coa
PDB Compounds: (B:) 3-hydroxy-3-methylglutaryl-coenzyme A reductase

SCOPe Domain Sequences for d4i4bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i4bb1 d.179.1.1 (B:503-610,B:721-878) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
ldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpy
avasnfqingrdvlvplvveepsivaaasymaklaranggfttsssapXrlaraqvritp
qqletaefsgeaviegildayafaavdpyraathnkgimngidplivatgndwraveaga
hayacrsghygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaq
alaeiavavglaqnlgamralategiq

SCOPe Domain Coordinates for d4i4bb1:

Click to download the PDB-style file with coordinates for d4i4bb1.
(The format of our PDB-style files is described here.)

Timeline for d4i4bb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i4bb2